PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00900.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 702aa    MW: 77311 Da    PI: 4.5437
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00900.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1501.1e-46251521128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtd el+++yLk+k+ gkkl + e i+e++iyk+ PwdLp k ++k+++ ewyfF++r++kya+g r nrat+sgyWk
  Sme2.5_00900.1_g00003.1  25 LAPGFRFHPTDVELIMYYLKRKIMGKKLLF-EGITELNIYKYSPWDLPdKcCYKSKDLEWYFFCPRERKYASGARMNRATESGYWK 109
                              579************************888.78***************6545666777**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd+ v+  +++ vg  ktLvf+ g+ p+g++tdWv+hey++
  Sme2.5_00900.1_g00003.1 110 TTGKDRFVTY-DERIVGSVKTLVFHLGHPPRGQRTDWVIHEYKF 152
                              *********9.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5416188IPR003441NAC domain
PROSITE profilePS5100552.11325188IPR003441NAC domain
PfamPF023653.3E-2427151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MSVGSSKKHQ FFVWSAFLFM NLRRLAPGFR FHPTDVELIM YYLKRKIMGK KLLFEGITEL  60
NIYKYSPWDL PDKCCYKSKD LEWYFFCPRE RKYASGARMN RATESGYWKT TGKDRFVTYD  120
ERIVGSVKTL VFHLGHPPRG QRTDWVIHEY KFEDKESIDA GFAQHCWPPP KELLGSKDSH  180
VLCKVFQKSG PGPRNGAQYG APFKEEDWED DEYPAEPCTS DVFPVPPERP DNRSNSNVTR  240
VVDPGSTSDW PSSEQSPSLI QPSIQEMPLD EPDGAELPGQ PNQIDDESVP GESKSSNIFS  300
ALPILPVKQS CSVVNSMVNP GSGPSNGQMC TNEVALDEQD DEINCLLAQF TEDTTLLPGG  360
NETNQKKLEN FNQDVNAPAA TFTDGNDIFD GLGDIEFWAG VGQPGPDLSA SGGSNYSLNP  420
MILPQDAAYM ELNDLDIPLN HSAETIGTGQ LVPGHLCMPY SSNNGMHQLC FGSNSLGIVQ  480
DFSEHHLPLL PEHYTRQVNH SDMVYNFQDN SSQGCNAETS FSVSSYKEPE ESRLDNQNLE  540
RGVQQQKFYL SIFALCDGSF ILVKAEVTLG VDGCTDDALS VVRGEQTTLY SSIFALCGGS  600
FILVKAEVTL GVDGCTYDAL SVILGEQRKL YSSIFALYGG SILVKAEVTL GVCGCTNEAF  660
AVSLGSTCLK CIIVMIPNPI FLSGVGVWAK VVALLPPLGK VG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-422515215140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136830.0BT013683.1 Lycopersicon esculentum clone 132505F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165758.10.0PREDICTED: NAC domain-containing protein 82-like isoform X1
RefseqXP_015165757.10.0PREDICTED: NAC domain-containing protein 82-like isoform X1
TrEMBLK4D4K50.0K4D4K5_SOLLC; Uncharacterized protein
STRINGSolyc11g005920.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.45e-79NAC domain containing protein 82